<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15903
| Description |
Uncharacterized protein |
| Sequence | MDSTSQMENADGTNWQEETYQKIKSMMVKHLPELNALYQKIASKVQQSHSSSATRVKGVRVTGDSTTEAAAAEIGDLIEMMQNLVTKVGHLAGKVSSLERLDSAVMELKQ |
| Length | 110 |
| Position | Tail |
| Organism | Capsicum annuum (Capsicum pepper) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Capsiceae> Capsicum.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.460 |
| Instability index | 29.98 |
| Isoelectric point | 5.88 |
| Molecular weight | 12068.56 |
| Publications | PubMed=29089032
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | chromatin DNA binding GO:0031490 IBA:GO_Central
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP15903
No repeats found
|