<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15898
Description |
Uncharacterized protein |
Sequence | MLAYGLRKPLQELLDGMALLEQQATSLVDVALDADSNDGSFGWLALQEQWRRGFPCRSSMVHAGCVGVLASCHSLDIAGVELIDPLSADVSFCVLVEALFFLAGLLYLLP |
Length | 110 |
Position | Kinase |
Organism | Capsicum annuum (Capsicum pepper) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Capsiceae> Capsicum.
|
Aromaticity | 0.08 |
Grand average of hydropathy | 0.587 |
Instability index | 43.87 |
Isoelectric point | 4.29 |
Molecular weight | 11854.64 |
Publications | PubMed=29089032
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP15898
No repeats found
No repeats found
|