<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15881
| Description |
Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MPMPSPWPLTTPLPRPCHPNAIAFAAPLXPWPLTTPLPRPCHPNAIAFAAPLPRPCHVSAITCAMPLPWLRHRYQAKAVEFPKDFMGISLQEQPDMYYMIIRQQRLIMEAESSMQEIMEKLQSYKTRIAISFENLRXQYRLGDFRLRVGKVSPVNSENLRGIMMEMEYLPISSWETSHQIMNEFFDILKETLGGRSLPGHFVHVEPNFSEYGLSDQYTSQHTAVQYASFMAQMISTVNDAEKGSDIDPQEAQQTLEIAEAENLMFGSVEWQ |
| Length | 271 |
| Position | Head |
| Organism | Capsicum annuum (Capsicum pepper) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Capsiceae> Capsicum.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.306 |
| Instability index | 51.05 |
| Isoelectric point | 5.50 |
| Molecular weight | 30758.06 |
| Publications | PubMed=29089032
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP15881
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 137.81| 22| 22| 6| 27| 1
---------------------------------------------------------------------------
2- 25 (43.53/20.85) .PmpsPWPLTTPLPRPCHPNAIAFA
26- 49 (49.51/24.56) AP.lxPWPLTTPLPRPCHPNAIAFA
51- 64 (23.40/ 8.38) ...........PLPRPCHVSAITCA
65- 81 (21.38/ 7.12) MP..lPW.....LRHRYQAKAVEF.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.45| 13| 15| 157| 171| 2
---------------------------------------------------------------------------
157- 171 (19.29/17.05) ENLRGIMmeMEYLPI
175- 187 (24.16/13.91) ETSHQIM..NEFFDI
---------------------------------------------------------------------------
|