<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15880
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MNGVREGKWKATLNFYKPIFREQANALEFPREFLGISLQEQPNKHYMVIRGQRLFVEAESSIQEVINLSSTIHSLGFVNXEFLGISLQEQPNKHYMVIRGQRLVMEAESSIQVIMEKLQSYKTRAVLNFEEVINLSSTIHSLGFVNLSMYGRYYLHLLCFNVL |
Length | 163 |
Position | Head |
Organism | Capsicum annuum (Capsicum pepper) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Capsiceae> Capsicum.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.090 |
Instability index | 49.75 |
Isoelectric point | 7.89 |
Molecular weight | 18819.54 |
Publications | PubMed=29089032
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP15880
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 148.57| 37| 46| 27| 63| 1
---------------------------------------------------------------------------
27- 63 (76.72/54.10) LEFPR.EFLGISLQEQPNKHYMVIRGQRLFVEAESSIQ
75- 112 (71.85/50.27) LGFVNxEFLGISLQEQPNKHYMVIRGQRLVMEAESSIQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.26| 11| 65| 64| 74| 2
---------------------------------------------------------------------------
64- 74 (22.13/21.17) EVINLSSTIHS
131- 141 (22.13/21.17) EVINLSSTIHS
---------------------------------------------------------------------------
|