<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15871

Description Uncharacterized protein
SequenceMVPGYLRNRPPIPPLAGPAPGAIPSMSLQVTGRPVVGMHSMPQGPPIPYDFQRNLPMSSNHMPGSGGPNLPLSSSYNVNADSSGSQYQTQINDDRFPSGVQPWMPISNHNVNSATTMQKTGELAAPLVVPGTDASTDFREFTSPEGRKYYYNKVTRTSKWRMSDEVKLAREKDTISHASDFGSISVVKTSSSGADGSLVSTHGAKSSLTVVSPAANLPTIVASESSSLSGKVSSSMIEIVEMKNSSEPASPAVANSEKIGIAVTLGNSIVPPVSENTTTQDTVVYGDGFSSENRENVKKDAAITEIGGATPSDEKTVELGPLVYESKAAKSAFKTLLESANIGSDCTWDQAMRAVINDRRYGVLKCLCERKQAFNKVSPQKKLEAEARRVKQKKARKDFKIMLEDCKELSPSSRWSKAISIFKHDEHFKAVKRAKDREDLFEDYVEELEKMVKLLLQNFLASSQWRKVQDRLETDERCSHLEKIDRLEIFQEYIRDLESKEEEQRKLRMEELRKAECKNRDEFQKLMEEHATAGILNTKTNWRDYCIKIKDFAAYVAVSSNTIGSTANGLFTDVMDELEKQVK
Length583
PositionUnknown
OrganismCapsicum annuum (Capsicum pepper)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Solanoideae> Capsiceae> Capsicum.
Aromaticity0.06
Grand average of hydropathy-0.583
Instability index46.31
Isoelectric point7.12
Molecular weight64598.22
Publications
PubMed=29089032

Function

Annotated function 
GO - Cellular Component
U1 snRNP	GO:0005685	IBA:GO_Central
U2-type prespliceosome	GO:0071004	IBA:GO_Central

GO - Biological Function
RNA binding	GO:0003723	IBA:GO_Central

GO - Biological Process
mRNA cis splicing, via spliceosome	GO:0045292	IEA:InterPro
mRNA splicing, via spliceosome	GO:0000398	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP15871
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      98.54|      25|      32|      57|      88|       1
---------------------------------------------------------------------------
   37-   54 (26.52/11.83)	..GMHsMP..QGPPIP....YDF.......QRN
   57-   88 (37.09/35.40)	MSSNH.MPGSGGPNLPLsSSYNVNadssgsQYQ
   91-  112 (34.93/16.13)	INDDR.FPSGVQPWMPI.SNHNVN.........
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.48|      17|      17|     495|     511|       2
---------------------------------------------------------------------------
  495-  511 (27.74/19.47)	RDLESKEEEQRKLRMEE
  513-  529 (29.74/21.39)	RKAECKNRDEFQKLMEE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.41|      17|      18|     251|     267|       3
---------------------------------------------------------------------------
  244-  266 (21.21/10.43)	NssepasPAVANSEKIGIAVTLG
  267-  286 (19.20/ 8.83)	N...sivPPVSENTTTQDTVVYG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.69|      16|      87|     318|     334|       6
---------------------------------------------------------------------------
  318-  334 (24.25/16.10)	ELGPLVYESKAAkSAFK
  408-  423 (29.43/15.66)	ELSPSSRWSKAI.SIFK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.86|      18|      32|     432|     460|       8
---------------------------------------------------------------------------
  432-  450 (24.64/18.41)	KRAKDREDLfEDYVEELEK
  466-  483 (30.22/23.06)	RKVQDRLET.DERCSHLEK
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP15871 with Med35 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) VPGYLRNRPPIPPLAGPAPGAIPSMSLQVTGRPVVGMHSMPQGPPIPYDFQRNLPMSSNHMPGSGGPNLPLSSSYNVNADSSGSQYQTQINDDRFPSGVQPWMPISNHNVNSATTMQKTGELAAPLVV
2
129










Molecular Recognition Features






MoRF SequenceStartStop




NANANA