<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15863

Description Uncharacterized protein
SequenceMAGKVEGPAIGIDLGTTYSCVAVWKYDRVEIIANDQGNRTTPSYVGFTDCERLIGDAAKNQVSINPINTVFDAKRLIGRRFSDALVQSDIKHWPFKVISGHGDKPMIVVNHKGEEKQFAAEEISSMVLVKMREIAEAFLGSTVKNTVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDEKETSVGQKNVLIFDLGGGTFDVSLLTIDEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNNKDISGNPRSLRRLRTACERAKRTLSSTAQTTIVIDYLYEDIDFNSTITRARFEELNMDLFRKCMEPVEQCLRDAKMDKSAIHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNKKVKDLLLLDVTPLSLGLETYGGVMTVLIPRNTTIPAKKEGVFSTCSDNQPDVLIKVYEGERTRTRDSNLLGKFELSGIRPAPRGVPQITVCFDIDADGILNVAAEDKTTKQKNKITITNDNDRLSKEKIDKMVQEAEKYKSEDEAHKKKVDAKNALENCAYNMRNNIKDERIASKLPEADKKKIEDAIEQVIQWLDANQLAESNELEDKTKELENICNPIIAKMYEGAGGDIGADMDNDGPAPSSSSGAGPKIEKVD
Length649
PositionUnknown
OrganismCapsicum annuum (Capsicum pepper)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Solanoideae> Capsiceae> Capsicum.
Aromaticity0.06
Grand average of hydropathy-0.405
Instability index32.54
Isoelectric point5.33
Molecular weight71493.28
Publications
PubMed=29089032

Function

Annotated function 
GO - Cellular Component
cytoplasm	GO:0005737	IBA:GO_Central

GO - Biological Function
ATP binding	GO:0005524	IBA:GO_Central
ATPase activity	GO:0016887	IBA:GO_Central
heat shock protein binding	GO:0031072	IBA:GO_Central
misfolded protein binding	GO:0051787	IBA:GO_Central
protein folding chaperone	GO:0044183	IBA:GO_Central
unfolded protein binding	GO:0051082	IBA:GO_Central

GO - Biological Process
cellular response to unfolded protein	GO:0034620	IBA:GO_Central
chaperone cofactor-dependent protein refolding	GO:0051085	IBA:GO_Central
protein refolding	GO:0042026	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP15863
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     128.99|      32|      74|     341|     372|       1
---------------------------------------------------------------------------
  341-  372 (55.78/35.82)	VLVGGSTRIPKVQQLLQDFFNGKELCKSINPD
  385-  410 (30.75/16.58)	ILSGEGNK..KVKDLL..LLDVTPLSLGLE..
  418-  443 (42.46/25.58)	VLIPRNTTIPAKK...EGVFST...CSDNQPD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      75.75|      18|      21|      38|      55|       2
---------------------------------------------------------------------------
   16-   33 (18.01/10.61)	..TT..YSCVAVWKYDRveIIA
   38-   55 (34.62/27.74)	NRTT..PSYVGFTDCER..LIG
   60-   78 (23.11/15.87)	NQVSinPINTVF.DAKR..LIG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.73|      20|      32|     529|     558|       5
---------------------------------------------------------------------------
  529-  550 (29.54/37.66)	EKYKSE.DEAHKKKVDakNALEN
  562-  582 (29.18/10.87)	ERIASKlPEADKKKIE..DAIEQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.26|      14|      22|      91|     112|       8
---------------------------------------------------------------------------
   91-  109 (20.70/30.62)	KHWPFKVISGhgdkpMIVV
  116-  129 (22.57/ 8.19)	KQFAAEEISS.....MVLV
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP15863 with Med37 domain of Kingdom Viridiplantae
Unable to open file!