<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15835

Description Uncharacterized protein
SequenceMTFKSSHRARSRSVTKLIFLSGFKHDAIPQRPQNEQIEKLKKFKAVLEHIVIFLQLNKHDIQLAHKEKLCSVERHIGFFLSKPTSPPLQGQLPQSSMQLQLPQSLDVQTNPPTQPQLHQALSSQAQSTGALQTATLDSGGQDIPSEFDLMAVLLELIYVSNGVDTLDGSSGALCSDSTSQTGNVDGADWQEELYQEIKTMREKNLPELNALYQKIASKVQQHDAIPQRPQNEQIEKLKKFKAVLERIVIFLQLNKHDIQLTHKEKLCSVERHIGFFLSKPTSPPLQGQLPQSSMQLQQPQSLDVQTNPPTQPQLHQALSSQAQSTGAHQTAMLESGGQDTASKSD
Length345
PositionTail
OrganismCapsicum baccatum (Peruvian pepper)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Solanoideae> Capsiceae> Capsicum.
Aromaticity0.05
Grand average of hydropathy-0.555
Instability index56.08
Isoelectric point6.90
Molecular weight38397.07
Publications
PubMed=29089032

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
chromatin DNA binding	GO:0031490	IEA:InterPro
transcription coactivator activity	GO:0003713	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP15835
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     163.16|      22|      23|      84|     105|       1
---------------------------------------------------------------------------
   84-  105 (47.02/16.78)	TSPPLQGQLPQS.SMQLQLPQSL
  109-  131 (40.62/13.73)	TNPPTQPQLHQAlSSQAQSTGAL
  281-  302 (47.58/17.04)	TSPPLQGQLPQS.SMQLQQPQSL
  306-  323 (27.94/ 7.70)	TNPPTQPQLHQAlSSQAQ.....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     143.11|      19|      23|      36|      54|       2
---------------------------------------------------------------------------
   36-   54 (34.84/24.73)	QIEKLKKFKAVLEHIVIFL
   62-   80 (37.43/27.06)	QLAHKEKLCSVERHIGFFL
  233-  251 (33.15/23.21)	QIEKLKKFKAVLERIVIFL
  259-  277 (37.69/27.30)	QLTHKEKLCSVERHIGFFL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.82|      19|     195|      24|      61|       3
---------------------------------------------------------------------------
   24-   61 (30.27/17.75)	KHDAIPQRPQNEqieklkkfkavlehiviflQLNKHDI
  221-  258 (30.55/17.98)	QHDAIPQRPQNEqieklkkfkavleriviflQLNKHDI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.31|      17|     195|     132|     148|       4
---------------------------------------------------------------------------
  132-  148 (33.27/20.03)	QTATLDSGGQDIPSEFD
  329-  345 (32.04/19.06)	QTAMLESGGQDTASKSD
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP15835 with Med15 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) KPTSPPLQGQLPQSSMQLQQPQSLDVQTNPPTQPQLHQALSSQAQSTGAHQTAMLESGGQDTASKSD
279
345










Molecular Recognition Features






MoRF SequenceStartStop




NANANA