<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15831
| Description |
Mediator of RNA polymerase II transcription subunit 21 |
| Sequence | MDIISQLQEQVNTIAALTFNTFGTLQRDAPPVRLSPNYPEPPPVNPTEDSTNVAEQPKQMSAAFVKAAKQFDALVAALPLSDGGEEAQLKRIAELQDENDAVGQELQKQLEAAEKELKQVKELFNQATDNCLNLKKPE |
| Length | 138 |
| Position | Middle |
| Organism | Capsicum baccatum (Peruvian pepper) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Capsiceae> Capsicum.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.579 |
| Instability index | 61.32 |
| Isoelectric point | 4.53 |
| Molecular weight | 15172.85 |
| Publications | PubMed=29089032
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP15831
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.11| 19| 47| 55| 74| 1
---------------------------------------------------------------------------
55- 74 (27.95/22.23) EQPKQMSAAfVKAAKQFDAL
105- 123 (30.16/18.52) ELQKQLEAA.EKELKQVKEL
---------------------------------------------------------------------------
|