<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15825

Description Uncharacterized protein
SequenceMKVKVDDGDSTGGAPPATTAKITVVVAVKSAEGRGSQRAVKWAVEKLLQKAHKFVFIHVMNTITTIPTPSGESIPVDDLEASVVKLYTEDKRAKCEEIFIPFKSLCKRRNAETLVLEGNNPATVLLKYVNDSRIKSFVLGSYSPSYFARKLKGSSVPSIILKHAPDCCDVYVVSSTKLMTNSLNPLLAAEDNLSRTINKQQSSASSVSAGSVFHNRSSSVASSHLSSTEFVHGNSSNYVSPQRGTNRNLEDVTTGLEAVKGCHSSTYSEQLDIQDEVERLRVELQDTLAMYNQAREDLAHARNKVQLFSSQYLEESEKVNAAKKREENLRKIAAEEKEKHMEAEKEVEIARKLLSEEVYERQIAELKALQHTLEKKKIVDKLLSSDGRYRRFTTEEIEVATDYFSESKMIGEGAYGKVYKGDLDRTPVAIKVLCSDASEKKDEFLKEVEVLSQLHHPHIVLLLGACPDYGCLVYEYMENGNLEDYILERNNKSFPWFSRFRILFEVACALAFLHNSKPEPIVHRDIKPGNILLDKNFVSKVGDVGLAMFISDVVPESVTEYRNSVLAGTFAYMDPEYLRTGTLRPKSDLYAFGVIVLQLLAARRPNGLIMKFEDAINCHSLVDILDNSVTDWPLTEAEELARMALNCCKLRCRDRPDLETEVLPLLKRLAEFADMHSNVEKNLIQAPSPYLCPILQEVMEDPQIAADGFTYERRAIQLWLDRYSVSPVTKQIMQHKLITPNHTLRLAIQEWRSHSTSLR
Length759
PositionTail
OrganismCapsicum baccatum (Peruvian pepper)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Solanoideae> Capsiceae> Capsicum.
Aromaticity0.07
Grand average of hydropathy-0.328
Instability index46.08
Isoelectric point6.25
Molecular weight85446.56
Publications
PubMed=29089032

Function

Annotated function Functions as an E3 ubiquitin ligase. 
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein serine/threonine kinase activity	GO:0004674	IEA:UniProtKB-KW
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP15825
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.06|      19|      19|     314|     332|       1
---------------------------------------------------------------------------
  314-  332 (30.63/19.72)	EESEKVNAAKKREENLRKI
  335-  353 (31.43/20.41)	EEKEKHMEAEKEVEIARKL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     160.07|      48|     408|     263|     312|       3
---------------------------------------------------------------------------
  263-  312 (74.57/57.97)	HSSTysEQLDIQDEVERLRVELQDTLAMYNQAREDLAHARNKVQLFSSQY
  676-  723 (85.50/59.45)	HSNV..EKNLIQAPSPYLCPILQEVMEDPQIAADGFTYERRAIQLWLDRY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.08|      15|      15|     204|     218|       5
---------------------------------------------------------------------------
  204-  218 (26.23/17.17)	ASS.VSAGSVFHNRSS
  221-  236 (21.85/13.15)	ASShLSSTEFVHGNSS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP15825 with Med32 domain of Kingdom Viridiplantae
Unable to open file!