<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15819
| Description |
Uncharacterized protein |
| Sequence | MMIQMTFLGNFVSCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQIPSQQQQQQPPPPQQLQAQHPQLQQQQQHLSQLQQQPLQQMQQQQQQPLMQLQQQQQIPLQQSQVPQMQQQHIHQLQQQQQQIPQIQQPQQQQPMVGTGMNQAYLQGPARSQLMTQGQAPAERSTCAPSSQIKVAVKVWACGHRYLSSYTAPVGARSYVWPGVCPDPGYVTYILEAL |
| Length | 227 |
| Position | Unknown |
| Organism | Capsicum baccatum (Peruvian pepper) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Capsiceae> Capsicum.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.535 |
| Instability index | 85.73 |
| Isoelectric point | 8.91 |
| Molecular weight | 25664.20 |
| Publications | PubMed=29089032
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP15819
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.00| 20| 30| 2| 22| 3
---------------------------------------------------------------------------
2- 22 (34.11/25.28) MIQMTFLGNFVSCAvIQLPSQ
35- 54 (38.88/24.36) LIGMLFPGDMVVFK.PQIPSQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.94| 18| 62| 56| 73| 4
---------------------------------------------------------------------------
56- 73 (38.01/11.79) QQQQPPPPQQLQAQHPQL
119- 136 (34.93/10.12) QQQHIHQLQQQQQQIPQI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.98| 10| 30| 169| 178| 5
---------------------------------------------------------------------------
169- 178 (19.86/14.00) AP.AERSTCAP
201- 211 (17.12/11.18) APvGARSYVWP
---------------------------------------------------------------------------
|