<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15818

Description Uncharacterized protein
SequenceMAGKVEGPAIGIDLGTTYSCVAVWKYDRVEIITNDQGNRTTPSYVGFTDCERLIGDAAKNQVSINPINTVFDAKRLIGRRFSDALVQSDIKHWPFKVISGHGDKPMIVVNHKGEEKQFAAEEISSMVLVKMREIAEAFLGSTVKNTVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDEKETSVGEKNVLIFDLGGGTFDVSLLTIDEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNNKDISGNPRSLRRLRTACERAKRTLSSTAQTTIVIDYLYEDIDFNSTITRARFEELNMDLFRKCMEPVEQCLRDAKMDKSAIHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNKKVKDLLLLDVTPLSLGLETYGGVMTVLIPRNTTIPAKKEGVFSTCSDNQPDVLIKVYEGERTRTRDSNLLGKFELSGIRPAPRGVPQITVCFDIDADGILNVAAEDKTTKQKNKITITNDKDRLSKEKIDKMVQEAEKYKSEDEAHKKKVDAKNALENCAYNMRNNIKDERIASKLPEADKKKIEDAIEQVIQWLDANQLAESNELEDKTKELENICNPIIAKMYQGAGGDIGADMDNDGPAPSSSSGAGPKIEKVD
Length649
PositionUnknown
OrganismCapsicum baccatum (Peruvian pepper)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Solanoideae> Capsiceae> Capsicum.
Aromaticity0.06
Grand average of hydropathy-0.410
Instability index32.18
Isoelectric point5.38
Molecular weight71537.38
Publications
PubMed=29089032

Function

Annotated function
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-KW
ATPase activity	GO:0016887	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP15818
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     128.99|      32|      74|     341|     372|       1
---------------------------------------------------------------------------
  341-  372 (55.78/35.43)	VLVGGSTRIPKVQQLLQDFFNGKELCKSINPD
  385-  410 (30.75/16.38)	ILSGEGNK..KVKDLL..LLDVTPLSLGLE..
  418-  443 (42.46/25.29)	VLIPRNTTIPAKK...EGVFST...CSDNQPD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      75.97|      18|      21|      38|      55|       2
---------------------------------------------------------------------------
   16-   33 (18.26/11.26)	..TT..YSCVAVWKYDRveIIT
   38-   55 (34.61/28.84)	NRTT..PSYVGFTDCER..LIG
   60-   78 (23.10/16.47)	NQVSinPINTVF.DAKR..LIG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      81.75|      29|      31|     529|     558|       5
---------------------------------------------------------------------------
  529-  557 (52.04/43.60)	EKYKSE.DEAHKKKV...........DA.....KNALENCAYNMRN
  562-  607 (29.71/15.95)	ERIASKlPEADKKKIedaieqviqwlDAnqlaeSNELEDKTKELEN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.26|      14|      22|      91|     112|       7
---------------------------------------------------------------------------
   91-  109 (20.70/28.25)	KHWPFKVISGhgdkpMIVV
  116-  129 (22.57/ 7.42)	KQFAAEEISS.....MVLV
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP15818 with Med37 domain of Kingdom Viridiplantae

Unable to open file!