<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15817

Description Uncharacterized protein
SequenceMAGKVEGPAIGIDLGTTYSCVAVWKYDRIEIIANDQGNRTTPSYVGFTDCEHLIGDAAKNQVSINPINTVFDAKRLIGRRFSDALVQSDIKHWPFKVISGHGDKPMIVVNHKGEEKQFAAEQISSMVLVKMREIAEAFLGSTVKNTVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDEKETSVGEKNVLIFDLGGGTFDVSLLTIDEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNNKDISGNPRSLRRLRTACERAKRTLSSTAQTTIEIDYLYEDIDFNSTITRARFEELNMDLFRKCMEPVKQCLRDAKMDKSAIHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNKKVKDLLLLDVTPLSLGLETYGGVMTVLIPRNTTIPAKKEGVFSTCSDNQPDVLIKVYEGERTRTRDSNLLGKFELSGIRPAPRGVPQITVCFDIDADGILNVAAEDKTTKQKNKITITNDKDRLSKEKIDKMVQEAEKYKSEDEAHKKKVDAKNALENCAYNMRNNIKDERIASKLPEADKKKIEDAIEQVIQWLDANQLAESNELEDKTKELENICNPIIAKMYQGAGGDIGADMDNDGPAPSSSSGAGPKIEKVD
Length649
PositionUnknown
OrganismCapsicum baccatum (Peruvian pepper)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Solanoideae> Capsiceae> Capsicum.
Aromaticity0.06
Grand average of hydropathy-0.416
Instability index33.59
Isoelectric point5.48
Molecular weight71530.39
Publications
PubMed=29089032

Function

Annotated function
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-KW
ATPase activity	GO:0016887	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP15817
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      80.86|      25|      41|     511|     535|       1
---------------------------------------------------------------------------
  511-  535 (41.75/26.84)	NDKDRLSKEKIDKMVQEAEKYKSED
  554-  578 (39.11/24.69)	NMRNNIKDERIASKLPEADKKKIED
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     147.77|      32|      74|     341|     372|       2
---------------------------------------------------------------------------
  323-  339 (19.38/ 7.58)	...........VKQCLRD....AKMDKSAIHD
  341-  372 (55.31/33.65)	VLVGGSTRIPKVQQLLQDFFNGKELCKSINPD
  385-  410 (30.69/15.78)	ILSGEGNK..KVKDLL..LLDVTPLSLGLE..
  418-  443 (42.39/24.28)	VLIPRNTTIPAKK...EGVFST...CSDNQPD
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP15817 with Med37 domain of Kingdom Viridiplantae

Unable to open file!