<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15808
Description |
Cyclin-C1-1 (Fragment) |
Sequence | MAANFWISSQFKELLEQEEVDVVHPLDKERGITLDDFKLIKLNMTNYVAKLAQSVKVRQRVVATAVTYMRRVYVRRSMTEYDPRLVAPACLYLASKAEESTVQAARHLVPCIKKLCSDETYKYEIKDILDMEMKVLEALNYNLVIYHPYRSLSQFLRDAGMTDATQLTWGLINDTYKMDLILIHPPHLITLACIYIASVLKDKETTAWFEELRVDMNVVKNIAMEILDYYENHRSITDE |
Length | 239 |
Position | Kinase |
Organism | Capsicum baccatum (Peruvian pepper) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Capsiceae> Capsicum.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.133 |
Instability index | 39.27 |
Isoelectric point | 5.75 |
Molecular weight | 27839.00 |
Publications | PubMed=29089032
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | cell cycle GO:0007049 IEA:UniProtKB-KW
cell division GO:0051301 IEA:UniProtKB-KW
regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP15808
No repeats found
|