<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15806
| Description |
Mediator of RNA polymerase II transcription subunit 19a |
| Sequence | MDPDSKKFGRGPIELTGARDLISHFKLLPHYEFFGKRSLPLSISDTHYLHNVVGDTEIRKGEEMQLDQLTQGTSFSRETSSRIQPFDLDILGQAFQLRDTAPISLSPSDRGTPTIAGKSKSEMKDKEKKHKKHKDKDKEKDKEHKKHKHRHKDRGKDKDKEKKKDKSGHHDLGSEHSRKHEKKRKHDEEDLNGVHRHKKSKHKSSKIDEIGGIKVAG |
| Length | 217 |
| Position | Head |
| Organism | Capsicum baccatum (Peruvian pepper) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Capsiceae> Capsicum.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.457 |
| Instability index | 39.02 |
| Isoelectric point | 9.66 |
| Molecular weight | 24952.82 |
| Publications | PubMed=29089032
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP15806
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.29| 17| 21| 133| 153| 1
---------------------------------------------------------------------------
133- 153 (28.53/16.32) HKDKDKEKdkehKKHKHRHKD
155- 171 (31.75/10.16) GKDKDKEK....KKDKSGHHD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.45| 17| 19| 69| 87| 2
---------------------------------------------------------------------------
69- 87 (26.15/23.43) LtqGTSFS.RETSS.RIQPFD
91- 109 (22.29/13.00) L..GQAFQlRDTAPiSLSPSD
---------------------------------------------------------------------------
|