<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15787
| Description |
Uncharacterized protein |
| Sequence | MDAIVDSMEKAYQEFVTAAAIVLETSEANGGKQVDGVDPSLESFIRHLQLFKDTCDEAQEFVEYLKNSLGCGKFPDNLSYSPEQVSDNDHSNSTSKTDANVESVASDVKSVATDVEYVATDLESVATDLDGLGVGIGGGLGCIGCGVGGPFVATGRISAGRS |
| Length | 162 |
| Position | Tail |
| Organism | Capsicum baccatum (Peruvian pepper) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Capsiceae> Capsicum.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.141 |
| Instability index | 26.03 |
| Isoelectric point | 4.14 |
| Molecular weight | 16879.33 |
| Publications | PubMed=29089032
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro
leaf senescence GO:0010150 IEA:InterPro
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
root development GO:0048364 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP15787
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.47| 14| 15| 35| 49| 1
---------------------------------------------------------------------------
35- 49 (21.04/14.74) DGVDPSLEsFIRHLQ
53- 66 (25.44/13.56) DTCDEAQE.FVEYLK
---------------------------------------------------------------------------
|