Description | Uncharacterized protein (Fragment) |
Sequence | MQSITNSTATTAAVQKPKNLLQILDVTRNIIDNYGFIINNARVNDPPVRYSHIHRRIYDEDCTFRMVHAAESLLKLVSELQKISMFLGFASLNDHVDQRIEDFTEQTKKTEGSLPRIGEETTASLKDLECHYYQRPYYCSAKRTSSL |
Length | 147 |
Position | Head |
Organism | Capsicum baccatum (Peruvian pepper) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Solanoideae> Capsiceae> Capsicum. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.495 |
Instability index | 59.32 |
Isoelectric point | 6.96 |
Molecular weight | 16900.94 |
Publications | PubMed=29089032 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP15782 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 103.87| 32| 50| 14| 45| 1 --------------------------------------------------------------------------- 14- 45 (52.87/36.92) VQKPKNLLQILDVTRNIIDNYGFIINNARVND 67- 98 (51.00/35.43) VHAAESLLKLVSELQKISMFLGFASLNDHVDQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) HYYQRPYYC 2) IHRRIY | 131 53 | 139 58 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab