<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15772
| Description |
Mediator of RNA polymerase II transcription subunit 19a |
| Sequence | MDPDSKRFGRGPGELTGAVDLISHFKLLSHHEFFCKRSLPLSISDTHYLHNVVGDTEIRKGEGMQLDQLIQDTSLSRETSSCIQPFDLDALGEAFQLREAAPVDLPHSEKGIPTVAGKSKSESKDKEKKHKKHKDKDKEKDKVHKKHKHRHRDRSKDKDKDKKRDKSGHHDSGADHSKKHHEKKRKHDGEEELNDVHKHKRSKNKSSKIDEIGAIKVAG |
| Length | 219 |
| Position | Head |
| Organism | Capsicum baccatum (Peruvian pepper) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Capsiceae> Capsicum.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -1.374 |
| Instability index | 40.25 |
| Isoelectric point | 9.38 |
| Molecular weight | 24950.70 |
| Publications | PubMed=29089032
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP15772
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
5| 118.80| 15| 15| 128| 142| 1
---------------------------------------------------------------------------
128- 142 (27.41/ 9.68) KKHK.KHKDKDKEKDK
145- 160 (21.76/ 6.15) KKHKhRHRDRSKDKDK
162- 176 (22.63/ 6.69) KKRD.KSGHHDSGADH
178- 192 (22.57/ 6.65) KKHH.EKKRKHDGEEE
197- 211 (24.43/ 7.82) HKHK.RSKNKSSKIDE
---------------------------------------------------------------------------
|