<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15771
Description |
Uncharacterized protein |
Sequence | MKLDQLIQYSSSLKETNLRIQLVDLDALRESFQLHEKTPIDLPSVFLVFHSLKKKHKKNKDKDKEHNKHKYRHKDRSKEKDKEKKKDRTDHHDSGADLSSGWRTWRNMARPFCCFVALAQG |
Length | 121 |
Position | Head |
Organism | Capsicum baccatum (Peruvian pepper) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Capsiceae> Capsicum.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -1.188 |
Instability index | 34.22 |
Isoelectric point | 9.70 |
Molecular weight | 14384.29 |
Publications | PubMed=29089032
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP15771
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.82| 14| 15| 55| 68| 1
---------------------------------------------------------------------------
55- 68 (26.26/13.91) KHK.KNKDKDKEHNK
72- 86 (20.55/ 9.54) RHKdRSKEKDKEKKK
---------------------------------------------------------------------------
|