Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSSGERSPKRQRLEGSYSPASPIPTFDTKTFIPPQTPPPSVRMSPSWTAQSLTAGQHQQQTGSGSGSGGTGSGTTFPTPPSTHGIYSHTNTHSGIDSARQTPAGDDEMDVRRTDENRRRDGDGDAEMTDTQAVDAGHRRTDHEREGTGGATAAASLTTSASASTMASGPAASPPIPGAGVLYRLRTAPIAPSRPHPTQDLLQLYDLKRIQASVARKDPVTGEKINVMRKSYANKVKALGLEGRNKAEANRHELEGLTDPGWGILVXGNKTMFQAHWESQNLVLGNADHENEMLRKLDSALKMEPGRLPKKEHDQWKGMLGLDESAATAAPVKSAGSKLPAGSALAKTAPAMAARSSAPSSPRGAGIRPDRSGKKRRYNDSSFEGYEQDDDGHHSAGMDDTGRRVSGSKRQKRQASEKSAAHQKGS |
Length | 425 |
Position | Head |
Organism | Ramularia collo-cygni |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Ramularia. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.926 |
Instability index | 53.63 |
Isoelectric point | 9.53 |
Molecular weight | 45110.25 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP15765 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 114.17| 44| 62| 210| 258| 1 --------------------------------------------------------------------------- 210- 241 (32.60/24.42) .................................Q.ASVARKDPV..TG..EKINVMRKSYANkvkALGLE 242- 303 (59.16/40.97) GR.NKAEANRHE.LEGLtdpgwgilvxgnktmfQ.AHWESQNLV..LGnaDHENEMLRKLDS...ALKME 305- 338 (22.40/ 9.01) GRlPKKEHDQWKgMLGL.................dESAATAAPVksAG..SKL................. --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 55.88| 16| 17| 104| 119| 2 --------------------------------------------------------------------------- 104- 119 (30.29/19.03) GDDEM.DVRRTDENRRR 123- 139 (25.59/15.02) GDAEMtDTQAVDAGHRR --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 33.18| 10| 26| 369| 380| 4 --------------------------------------------------------------------------- 369- 380 (14.66/14.63) DRSGkkRRYNDS 398- 407 (18.53/10.64) DDTG..RRVSGS --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 58.66| 19| 183| 162| 180| 5 --------------------------------------------------------------------------- 149- 167 (25.20/10.73) GATAAASLTTSASASTMAS 168- 186 (33.46/16.66) GPAASPPIPGAGVLYRLRT --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AVKKAIVPPIPLESLLRFSVGGLSL 2) GIRRTLW | 207 159 | 231 165 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab