<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15765
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSSGERSPKRQRLEGSYSPASPIPTFDTKTFIPPQTPPPSVRMSPSWTAQSLTAGQHQQQTGSGSGSGGTGSGTTFPTPPSTHGIYSHTNTHSGIDSARQTPAGDDEMDVRRTDENRRRDGDGDAEMTDTQAVDAGHRRTDHEREGTGGATAAASLTTSASASTMASGPAASPPIPGAGVLYRLRTAPIAPSRPHPTQDLLQLYDLKRIQASVARKDPVTGEKINVMRKSYANKVKALGLEGRNKAEANRHELEGLTDPGWGILVXGNKTMFQAHWESQNLVLGNADHENEMLRKLDSALKMEPGRLPKKEHDQWKGMLGLDESAATAAPVKSAGSKLPAGSALAKTAPAMAARSSAPSSPRGAGIRPDRSGKKRRYNDSSFEGYEQDDDGHHSAGMDDTGRRVSGSKRQKRQASEKSAAHQKGS |
| Length | 425 |
| Position | Head |
| Organism | Ramularia collo-cygni |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Ramularia.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.926 |
| Instability index | 53.63 |
| Isoelectric point | 9.53 |
| Molecular weight | 45110.25 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP15765
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 114.17| 44| 62| 210| 258| 1
---------------------------------------------------------------------------
210- 241 (32.60/24.42) .................................Q.ASVARKDPV..TG..EKINVMRKSYANkvkALGLE
242- 303 (59.16/40.97) GR.NKAEANRHE.LEGLtdpgwgilvxgnktmfQ.AHWESQNLV..LGnaDHENEMLRKLDS...ALKME
305- 338 (22.40/ 9.01) GRlPKKEHDQWKgMLGL.................dESAATAAPVksAG..SKL.................
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.88| 16| 17| 104| 119| 2
---------------------------------------------------------------------------
104- 119 (30.29/19.03) GDDEM.DVRRTDENRRR
123- 139 (25.59/15.02) GDAEMtDTQAVDAGHRR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 33.18| 10| 26| 369| 380| 4
---------------------------------------------------------------------------
369- 380 (14.66/14.63) DRSGkkRRYNDS
398- 407 (18.53/10.64) DDTG..RRVSGS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.66| 19| 183| 162| 180| 5
---------------------------------------------------------------------------
149- 167 (25.20/10.73) GATAAASLTTSASASTMAS
168- 186 (33.46/16.66) GPAASPPIPGAGVLYRLRT
---------------------------------------------------------------------------
|