| Description | Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MTTPEYRALEQLRTRLQQLSASIHLFRHELEASQPLPPWPACQTASSNLAGTLQNTAQVLASNRSLFSSAHAYPNASFPGLTQEALLQQLLRKKMDPKAEDWMDRELDKQPDNVEDRGELWQWAGGVVKEMRTDLEGGLWEDYFTTEEHKSGVKEVRTGIRRTLWGDNDDGDEDAEDDDGEGGEDEDGDKTMKEDGAVGSGRTVESAVKKAIVPPIPLESLLRFSVGGLSLPTRAKGRDVAG |
| Length | 242 |
| Position | Head |
| Organism | Ramularia collo-cygni |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Ramularia. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.750 |
| Instability index | 46.56 |
| Isoelectric point | 4.70 |
| Molecular weight | 26747.29 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP15763
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.67| 14| 16| 166| 180| 1
---------------------------------------------------------------------------
166- 180 (22.25/14.05) GDNDDGDEDAEdDDG
183- 196 (26.42/12.48) GEDEDGDKTMK.EDG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.97| 13| 22| 120| 140| 3
---------------------------------------------------------------------------
128- 140 (25.41/26.44) VKEMRTDLEGGLW
153- 165 (24.56/ 7.00) VKEVRTGIRRTLW
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) AVKKAIVPPIPLESLLRFSVGGLSL 2) GIRRTLW | 207 159 | 231 165 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab