Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MATATLDEVDTHLRGIISNLYMLIVQAHDYQGQATQQAMGTEIKNLLQNLQSLSQTARRLPTHIPLEIIQYVENSRNPDIYTREFVELVMRYNQQQKGRADAYAQFRDILGEAMMQGIPEIREDTQKVLEASGGRVKH |
Length | 138 |
Position | Middle |
Organism | Ramularia collo-cygni |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Ramularia. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.500 |
Instability index | 35.61 |
Isoelectric point | 5.77 |
Molecular weight | 15786.74 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP15755 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 65.94| 20| 28| 4| 23| 1 --------------------------------------------------------------------------- 4- 23 (33.42/23.76) ATLDEVDTHLRGIISNLYML 34- 53 (32.51/22.95) ATQQAMGTEIKNLLQNLQSL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IPLEIIQY 2) IYTREFVE 3) VMRYN 4) YAQFRDI | 64 80 89 103 | 71 87 93 109 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab