<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15752

Description Mediator of RNA polymerase II transcription subunit 5
SequenceMQLEGGGLHIPDWFSGGIYEALGTLAISVFENESFRGVHKHQWWKEQRPLIVGTMQNYDVNILQWTQSQLAGRLQNLIGRPPFIGTDDKGRPLFTDQQVLDAIPPVPVAHSRAGLFLWMNSALAARPLTDDMDVLSYLHARYSGNMQSAIVDLLVASFDNLTNSMLRKEPRQSVKVIRSFICNKVPVLISMLSGSIAPPMTAEACIQMAMAPGGLISMNPLPPISAGASDVQESLKHTRLEFLQACALHGLVTENTIATILHEAIALPRVTKYSKDGLVSQCANNVSRMEAIIDDLGGMQGNSGAIAGCIVQTIGNLCMTKDTMSLKTVCNELVKRMPLMDIIMQYTEPVHLLLPLCNLLDGWVHDQDQTEFTPSYEEFASILLLTLAVMHRYSIPSASLGLIGDNFVVRLLDEMSSSKSPSDMTTEQASQLEKWIEGLFAVDEHGETSGIGDEVMRQCSPRDFYLLVPTLFEQSVLACRYNALSSESFRGGLELLLEPFLLPSLIMGLGWLAEHSWEDHNDVEVLLQVLEKLLKPSSSSQETQAMHRAILGMVATPLYNSLQELHRQRPEKKKAAELSDLXRSHLNQQRNLHCSRAEMDEYMQDGTLNNRIRRSIXELVRWASTTTSPPDPPPRYAHKMFALACQIVDVEVLLDTIIEELASTPSANMPVALDVCTAMICAPAAGSIAQQKNHSAGVTARLRNKVRLIPSNVPALLGKPKAHAQALVNLSRQVESQLAIAQMPPMSIPMQLQEQAADQMMQDLGLDLPADISNVASDGKIDLAGLEQQMDFSNAALSNATVRQMETMAAENGAMELDQAXILGSLNMDLKNDQQLHLPNAEEDIFAGLDMDLGDDDFNFG
Length861
PositionTail
OrganismRamularia collo-cygni
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Ramularia.
Aromaticity0.05
Grand average of hydropathy-0.073
Instability index48.43
Isoelectric point4.95
Molecular weight94391.32
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP15752
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     128.96|      43|     125|     522|     566|       1
---------------------------------------------------------------------------
  522-  566 (63.66/54.18)	DVEVLLQ.VLEKLlKPSSSSQETQAMHrAILGMVATPLYNSL..QELH
  649-  694 (65.30/45.49)	DVEVLLDtIIEEL.ASTPSANMPVALD.VCTAMICAPAAGSIaqQKNH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      73.11|      19|      28|       7|      25|       2
---------------------------------------------------------------------------
    7-   25 (35.45/21.96)	GLHIPDWFSGGIYEALGTL
   37-   55 (37.66/23.76)	GVHKHQWWKEQRPLIVGTM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      77.06|      19|     121|     277|     303|       3
---------------------------------------------------------------------------
  277-  296 (28.58/16.18)	GLVSQCaNNVSRMEAIIDDL
  401-  415 (23.30/ 6.57)	GLIGD..NFVVRL...LDEM
  424-  439 (25.17/18.39)	MTTEQA....SQLEKWIEGL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.67|      17|     128|     122|     143|       4
---------------------------------------------------------------------------
   91-  113 (24.57/12.79)	RPLFTDQQVLDAIppvpvaHSR.A
  126-  143 (27.11/17.14)	RPLTDDMDVLSYL......HARyS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      35.29|      10|      24|     188|     200|       5
---------------------------------------------------------------------------
  188-  200 (14.77/12.37)	LISMlsgSIAPPM
  215-  224 (20.52/ 8.80)	LISM...NPLPPI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.91|      16|      17|     758|     773|       7
---------------------------------------------------------------------------
  758-  773 (28.25/17.17)	DQMMQDLGLDLPADIS
  778-  793 (27.66/16.66)	DGKIDLAGLEQQMDFS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP15752 with Med5 domain of Kingdom Fungi
Unable to open file!