<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15752
| Description |
Mediator of RNA polymerase II transcription subunit 5 |
| Sequence | MQLEGGGLHIPDWFSGGIYEALGTLAISVFENESFRGVHKHQWWKEQRPLIVGTMQNYDVNILQWTQSQLAGRLQNLIGRPPFIGTDDKGRPLFTDQQVLDAIPPVPVAHSRAGLFLWMNSALAARPLTDDMDVLSYLHARYSGNMQSAIVDLLVASFDNLTNSMLRKEPRQSVKVIRSFICNKVPVLISMLSGSIAPPMTAEACIQMAMAPGGLISMNPLPPISAGASDVQESLKHTRLEFLQACALHGLVTENTIATILHEAIALPRVTKYSKDGLVSQCANNVSRMEAIIDDLGGMQGNSGAIAGCIVQTIGNLCMTKDTMSLKTVCNELVKRMPLMDIIMQYTEPVHLLLPLCNLLDGWVHDQDQTEFTPSYEEFASILLLTLAVMHRYSIPSASLGLIGDNFVVRLLDEMSSSKSPSDMTTEQASQLEKWIEGLFAVDEHGETSGIGDEVMRQCSPRDFYLLVPTLFEQSVLACRYNALSSESFRGGLELLLEPFLLPSLIMGLGWLAEHSWEDHNDVEVLLQVLEKLLKPSSSSQETQAMHRAILGMVATPLYNSLQELHRQRPEKKKAAELSDLXRSHLNQQRNLHCSRAEMDEYMQDGTLNNRIRRSIXELVRWASTTTSPPDPPPRYAHKMFALACQIVDVEVLLDTIIEELASTPSANMPVALDVCTAMICAPAAGSIAQQKNHSAGVTARLRNKVRLIPSNVPALLGKPKAHAQALVNLSRQVESQLAIAQMPPMSIPMQLQEQAADQMMQDLGLDLPADISNVASDGKIDLAGLEQQMDFSNAALSNATVRQMETMAAENGAMELDQAXILGSLNMDLKNDQQLHLPNAEEDIFAGLDMDLGDDDFNFG |
| Length | 861 |
| Position | Tail |
| Organism | Ramularia collo-cygni |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Ramularia.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.073 |
| Instability index | 48.43 |
| Isoelectric point | 4.95 |
| Molecular weight | 94391.32 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364142
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP15752
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 128.96| 43| 125| 522| 566| 1
---------------------------------------------------------------------------
522- 566 (63.66/54.18) DVEVLLQ.VLEKLlKPSSSSQETQAMHrAILGMVATPLYNSL..QELH
649- 694 (65.30/45.49) DVEVLLDtIIEEL.ASTPSANMPVALD.VCTAMICAPAAGSIaqQKNH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.11| 19| 28| 7| 25| 2
---------------------------------------------------------------------------
7- 25 (35.45/21.96) GLHIPDWFSGGIYEALGTL
37- 55 (37.66/23.76) GVHKHQWWKEQRPLIVGTM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 77.06| 19| 121| 277| 303| 3
---------------------------------------------------------------------------
277- 296 (28.58/16.18) GLVSQCaNNVSRMEAIIDDL
401- 415 (23.30/ 6.57) GLIGD..NFVVRL...LDEM
424- 439 (25.17/18.39) MTTEQA....SQLEKWIEGL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.67| 17| 128| 122| 143| 4
---------------------------------------------------------------------------
91- 113 (24.57/12.79) RPLFTDQQVLDAIppvpvaHSR.A
126- 143 (27.11/17.14) RPLTDDMDVLSYL......HARyS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.29| 10| 24| 188| 200| 5
---------------------------------------------------------------------------
188- 200 (14.77/12.37) LISMlsgSIAPPM
215- 224 (20.52/ 8.80) LISM...NPLPPI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.91| 16| 17| 758| 773| 7
---------------------------------------------------------------------------
758- 773 (28.25/17.17) DQMMQDLGLDLPADIS
778- 793 (27.66/16.66) DGKIDLAGLEQQMDFS
---------------------------------------------------------------------------
|