<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15750

Description Probable Serine/threonine-protein kinase SSN3
SequenceMSGTTPYAPQRHINDNYDIVGFISSGTYGRVYKAVSKRTTQPPPTHPSGRPISAFAIKKFKPDKEGELQYTGISQSAIREMALCTELSHPALIHLVEIILESKCIFMVFEYAEHDLLQIIHHHSLLPRTPIPASTLRSCMYQIFSGLLYLHRNWVVHRDLKPANXMVTSSGSIKIGDLGLARLFFKPLHALFAGDKVVVTIWYRAPELLLGSRHYTPAIDLWAVGCIFAELLSLRPIFKGEEAKQDSKKAIPFQRNQMGKIGEVLGLPKKSEWPLLSAMPEFSHLASIQSQFPGVARPVGLEKWWRNTVGGNVYGKXGPPDSSAEELLRGLFIYDPLKRWTAEEALACKYFSEAGGGKESLWNCFEGLEKAYPARKVSSENEIGTGSMPGTKRSVLPGGEEGGGRAKKIREA
Length412
PositionKinase
OrganismRamularia collo-cygni
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Ramularia.
Aromaticity0.10
Grand average of hydropathy-0.229
Instability index48.71
Isoelectric point9.17
Molecular weight45518.01
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP15750
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      72.15|      21|     117|     205|     226|       1
---------------------------------------------------------------------------
  205-  226 (37.49/25.35)	APELLLGSRHYTPaIDLW....AVGC
  324-  348 (34.67/19.04)	AEELLRGLFIYDP.LKRWtaeeALAC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      75.18|      24|     117|     128|     154|       2
---------------------------------------------------------------------------
  128-  154 (36.58/33.55)	RTPIPAStlRSCMYQIfSGLLYLHR..NW
  248-  273 (38.60/23.41)	KKAIPFQ..RNQMGKI.GEVLGLPKksEW
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP15750 with CDK8 domain of Kingdom Fungi
Unable to open file!