<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15724
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MTEIFSTLFGQSDAQAPPSSAALGFGPGKPPPPHPQSAAPVPPQLSGQLGDEGPTARKPGVINEPFYLLRELPVGNDLTGNTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPGMIDSPGVQDGSSLRSLIEKPPVCGNSFSPLTGALLTGFRLHTGPLPEQYRLMHIQPPKKKSKHKHRHHRPQDPIPPETPSDSDPKKKKKKRDDDPERKKKKKDKKKKKNNRS |
| Length | 227 |
| Position | Head |
| Organism | Ictalurus punctatus (Channel catfish) (Silurus punctatus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Siluriformes>
Ictaluridae> Ictalurus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.023 |
| Instability index | 60.83 |
| Isoelectric point | 9.82 |
| Molecular weight | 25085.43 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP15724
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.14| 17| 24| 11| 27| 1
---------------------------------------------------------------------------
11- 27 (33.46/18.80) QSDAQAPPS.SAALG.FGP
36- 54 (25.69/12.79) QSAAPVPPQlSGQLGdEGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.83| 19| 21| 186| 206| 2
---------------------------------------------------------------------------
186- 206 (31.47/20.78) QDpiPPETPSDSDPKKKKKKR
208- 226 (32.36/14.95) DD..PERKKKKKDKKKKKNNR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.60| 10| 21| 111| 120| 3
---------------------------------------------------------------------------
111- 120 (20.15/ 9.03) PELPGMIDSP
135- 144 (21.45/ 9.99) PPVCGNSFSP
---------------------------------------------------------------------------
|