<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15723
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MTEIFSTLFGQSDAQAPPSSAALGFGPGKPPPPHPQSAAPVPPQLSGQLGDEGPTARKPGVINEPFYLLRELPGNDLTGNTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPGMIDSPGVQDGSSLRSLIEKPPVCGNSFSPLTGALLTGFRLHTGPLPEQYRLMHIQPPKKKSKHKHRHHRPQDPIPPETPSDSDPKKKKKKRDDDPERKKKKKDKKKKKVGGVIVHGKDGKERCIIFSKGE |
| Length | 244 |
| Position | Head |
| Organism | Ictalurus punctatus (Channel catfish) (Silurus punctatus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Siluriformes>
Ictaluridae> Ictalurus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.924 |
| Instability index | 52.73 |
| Isoelectric point | 9.72 |
| Molecular weight | 26825.51 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP15723
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 71.28| 14| 17| 190| 203| 1
---------------------------------------------------------------------------
170- 181 (22.46/ 9.89) P..PKKKSKHKHRH
190- 203 (24.80/11.67) PETPSDSDPKKKKK
209- 222 (24.02/11.08) PERKKKKKDKKKKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.60| 10| 21| 110| 119| 3
---------------------------------------------------------------------------
110- 119 (20.15/11.12) PELPGMIDSP
134- 143 (21.45/12.31) PPVCGNSFSP
---------------------------------------------------------------------------
|