<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15715
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MTEIFSSLYGQTEAQGPSAMGFGPGKPLPPPVPQNPVHMAVPIPHQLVDEGPPLRKPAAMNEPFYLVRELPMETELTGNTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPGMIDTQGLQDGSSLRSLIEKPPVCNNSFSPLTGTMLTGFRLHTGPLPEQYRLMHIQPPKKKSKHKHRHHRPQDPLPPETPSDSDHKKKKKKKDDDPDRKKKKKDKKKKKNRHSPDHPGTTSSQPSSSSLR |
| Length | 242 |
| Position | Head |
| Organism | Ictalurus punctatus (Channel catfish) (Silurus punctatus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Siluriformes>
Ictaluridae> Ictalurus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.078 |
| Instability index | 57.60 |
| Isoelectric point | 9.73 |
| Molecular weight | 27210.93 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP15715
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.65| 13| 18| 196| 208| 1
---------------------------------------------------------------------------
196- 208 (24.50/10.41) DHKKKKKKK.DDDP
216- 229 (20.16/ 7.27) DKKKKKNRHsPDHP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 141.64| 32| 114| 42| 74| 2
---------------------------------------------------------------------------
43- 74 (58.55/18.46) IPHQ..LVDEGPPLR....KPAAMNEPFYLVRELPMET
115- 144 (32.78/ 8.21) IDTQ..GLQDGSSLRslieKPPVCNNSFS.....PLT.
158- 191 (50.31/14.76) LPEQyrLMHIQPPKK....KSKHKHRHHRPQDPLPPET
---------------------------------------------------------------------------
|