<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15705
Description |
mediator of RNA polymerase II transcription subunit 22 |
Sequence | MATQRVLPQSKETLLQNYNKRLKDDIRSILDNFTEIIKTAKVEDETQVSRATQAEQDHYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAISLRNQQLRALQEECDKKLISLRDEIAVALYELEEEYYSSSCGQWDGVELPLCEAFRQRDSWGSPNMALDPSNPITDDSERPVATETMSHHLNGHGSSTNEQS |
Length | 200 |
Position | Head |
Organism | Ictalurus punctatus (Channel catfish) (Silurus punctatus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Siluriformes>
Ictaluridae> Ictalurus.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.660 |
Instability index | 67.81 |
Isoelectric point | 4.80 |
Molecular weight | 22770.10 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP15705
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.05| 13| 16| 98| 110| 1
---------------------------------------------------------------------------
98- 110 (22.27/13.59) ISLRNQQLRALQE
117- 129 (21.79/13.18) ISLRDEIAVALYE
---------------------------------------------------------------------------
|