<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15699
Description |
mediator of RNA polymerase II transcription subunit 30-like |
Sequence | MSSLPQKAPGGGLGGVPLQQQPQNLHTLACSGVPVLGQASNPAALREISPVFLCRIGQDTVQDIVTRTMEIFQITRATQLPNGVTQSQAAYQDRFGKLQEHLRQLSLLFRKLRLLYERCVEMTSDLQESPAELVPYVGEEMAPVRVEPCGSAVTQDKQEVLEKVRQKNQEMKVLMDQMRNLLWDINAMLTMRK |
Length | 193 |
Position | Head |
Organism | Ictalurus punctatus (Channel catfish) (Silurus punctatus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Siluriformes>
Ictaluridae> Ictalurus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.306 |
Instability index | 57.89 |
Isoelectric point | 7.66 |
Molecular weight | 21630.84 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP15699
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.31| 14| 15| 15| 28| 1
---------------------------------------------------------------------------
15- 28 (26.66/17.48) GVPLQQQPQNLHTL
32- 45 (24.65/15.63) GVPVLGQASNPAAL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.34| 15| 17| 65| 80| 2
---------------------------------------------------------------------------
65- 80 (20.75/21.75) VTRTMEIFQiTRATQL
84- 98 (25.59/20.49) VTQSQAAYQ.DRFGKL
---------------------------------------------------------------------------
|