<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15678
| Description |
Uncharacterized protein |
| Sequence | MATPPGANFDGNPPVAPQPPGTDMTGICFRDQLWLNTYPLDRNLIFDYFALSPFYDWTCNNEQLRLQSIHPLDISQLSKMTGIEYMLSEVMEPNLFVIRKQKRDSPEKVTPMLTYYILDGSIYQAPQLCNVFAARIGRALYYISKAFTAAASKLEKIGYVDEGEGVPSEPKAGKDLIDFKEVKRIDHILASLQRKLPPAPPPPPFPDGYVLPTTEAEKGAETQQGVESQPPVDPIIDQGPAKRMKF |
| Length | 246 |
| Position | Head |
| Organism | Manihot esculenta (Cassava) (Jatropha manihot) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Malpighiales> Euphorbiaceae> Crotonoideae> Manihoteae>
Manihot.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.378 |
| Instability index | 58.47 |
| Isoelectric point | 5.18 |
| Molecular weight | 27505.23 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP15678
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.98| 21| 57| 164| 185| 1
---------------------------------------------------------------------------
164- 185 (31.71/22.31) EGVPSEPKAgKDLIDFKEVKRI
224- 244 (39.27/23.03) QGVESQPPV.DPIIDQGPAKRM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.22| 14| 29| 28| 41| 3
---------------------------------------------------------------------------
28- 41 (29.85/23.11) CFRDQLWLNT.YPLD
59- 73 (23.37/16.58) CNNEQLRLQSiHPLD
---------------------------------------------------------------------------
|