| Description | Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MIGLAITSSFDCSPFIPWISLSSREKMTGIEYMLSEVMEPNLFVIRKQKRDSPEKVTPMLTYYILDGSIYQAPQLCNVFAARIGRALYYISKAFTAAASKLEKIGYVDEGEGVPSEPKAGKDLIDFKEVKRIDHILASLQRKLPPAPPPPPFPDGYVLPTTEAEKGAETQQGVESQPPVDPIIDQGPAKRMKF |
| Length | 193 |
| Position | Head |
| Organism | Manihot esculenta (Cassava) (Jatropha manihot) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Malpighiales> Euphorbiaceae> Crotonoideae> Manihoteae> Manihot. |
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.260 |
| Instability index | 57.58 |
| Isoelectric point | 5.94 |
| Molecular weight | 21405.54 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP15677 No repeats found |
| MoRF Sequence | Start | Stop |
| 1) AKRMKF 2) FPDGYVLPTTE 3) KEVKRIDHILASLQRKL | 188 152 127 | 193 162 143 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab