Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MIGLAITSSFDCSPFIPWISLSSREKMTGIEYMLSEVMEPNLFVIRKQKRDSPEKVTPMLTYYILDGSIYQAPQLCNVFAARIGRALYYISKAFTAAASKLEKIGYVDEGEGVPSEPKAGKDLIDFKEVKRIDHILASLQRKLPPAPPPPPFPDGYVLPTTEAEKGAETQQGVESQPPVDPIIDQGPAKRMKF |
Length | 193 |
Position | Head |
Organism | Manihot esculenta (Cassava) (Jatropha manihot) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Malpighiales> Euphorbiaceae> Crotonoideae> Manihoteae> Manihot. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.260 |
Instability index | 57.58 |
Isoelectric point | 5.94 |
Molecular weight | 21405.54 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP15677 No repeats found |
MoRF Sequence | Start | Stop |
1) AKRMKF 2) FPDGYVLPTTE 3) KEVKRIDHILASLQRKL | 188 152 127 | 193 162 143 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab