<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15668

Description Uncharacterized protein
SequenceMWLPKANGSKKGGNALVAVAIDKDKSSQNALKWALENLLSRGQTVVLIHVQCLDVVLEDYDVVKGLTEYVSYSAIENLVIGASKHGFIRKFKADIPSSVSKGAPDFCNVYVVSKGKVSSMRHASRAAPYASPLRDQIQVLNKQNDAPSTPPQDTSLSLHSGSIRERTPVKPRMSLDESFKSPFERAGRAFNVKSFAELMESDPDISFVSSGRPSTDRSSSVALDFIDSCLNARLSTSSETSFGSIRSGQKFNDLSSLHEFSSFSHDSARTSFSGSSQNLDDMEAEMRRLKLELKQTMDMYSTACKEALTAKQKAMELHRWRKEEERKLEEAKVAEEAALSAAEKEKDRCKAAMEAAEAAKKLAELEAQKRLTVEIKALKEAEEMKKVMEALAQQDVRYRRYNIEDIEEATEYFSAARKIGEGGYGPVYKCHLEHTQVAVKVLRPDAAQGRSQFQREVEVLSLIRHPNMVLLLGAVPEYGVLVYEYMANGSLDDCLFRKGDTPVLPWQLRFRIAAEIATGLLFLHQTKPEPLVHRDLKPDNVLLDHNYVCKISDVGLARLVPAIAENVTQYHMTSTAGTFCYIDPEYQQTGMLGVKSDVYSLGIMLLQIITARPPMGLTHIVEQSIENGVFREILDPAVPDWPLEETLTFAKLALQCAELRRKDRPDLGKVVLPELDKLRTYAQANMNQLMWMESACQSPHHSYTSTSQEVMSDPLIGHSESVKSQSSTSSLAEGT
Length735
PositionTail
OrganismManihot esculenta (Cassava) (Jatropha manihot)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Malpighiales> Euphorbiaceae> Crotonoideae> Manihoteae> Manihot.
Aromaticity0.07
Grand average of hydropathy-0.364
Instability index44.46
Isoelectric point6.12
Molecular weight81787.18
Publications

Function

Annotated function
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP15668
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.80|      21|      23|     322|     344|       1
---------------------------------------------------------------------------
  323-  343 (31.59/19.16)	EEER...KLEEAKVAEEAALSAAE
  345-  368 (25.21/13.54)	EKDRckaAMEAAEAAKKLAELEAQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      31.39|      10|      25|     374|     383|       2
---------------------------------------------------------------------------
  374-  383 (15.20/ 9.50)	EIKALKEAEE
  402-  411 (16.19/10.57)	NIEDIEEATE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.94|      17|      20|     162|     178|       3
---------------------------------------------------------------------------
  162-  178 (31.37/23.38)	SIRERT....PVKPRMSLDES
  181-  201 (22.58/14.52)	SPFERAgrafNVKSFAELMES
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     136.65|      40|     132|     469|     508|       5
---------------------------------------------------------------------------
  469-  508 (70.73/48.00)	VLLLGAVPEYGVLVYEYMANGSLDDCLFRKGDTPVLP.WQL
  603-  643 (65.92/44.27)	IMLLQIITARPPMGLTHIVEQSIENGVFREILDPAVPdWPL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      74.84|      24|      28|     227|     254|       6
---------------------------------------------------------------------------
  228-  253 (38.39/31.11)	SCLNARLS...TSSETSFGSirSGQKFND
  255-  281 (36.46/22.62)	SSLHEFSSfshDSARTSFSG..SSQNLDD
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP15668 with Med32 domain of Kingdom Viridiplantae

Unable to open file!