<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15662
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MASSPSKETDDAPDTPSSPKSIYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIAYLKYLQYWQRPEYMKFIMYPHCLFFLELLQNANFRNAMAHPGNKELAHRQQFFFWKNYRNNRLKHILPRPLPEPAPTPPASAPPAPPLQPMPPVLQTTIAMPTASASALSPMPYGIPPGSALAKNDMRNSGVDRRKRKKEV |
Length | 206 |
Position | Middle |
Organism | Manihot esculenta (Cassava) (Jatropha manihot) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Malpighiales> Euphorbiaceae> Crotonoideae> Manihoteae>
Manihot.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.637 |
Instability index | 65.23 |
Isoelectric point | 9.28 |
Molecular weight | 23694.95 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP15662
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.32| 18| 22| 39| 59| 2
---------------------------------------------------------------------------
39- 59 (28.96/23.06) FVQCLanpTYIHYLAQNRYFE
63- 80 (35.36/19.54) FIAYL...KYLQYWQRPEYMK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.72| 13| 26| 88| 105| 3
---------------------------------------------------------------------------
88- 105 (19.15/26.88) LFFLEllqnaNFRNA.MAH
117- 130 (23.57/16.78) FFFWK.....NYRNNrLKH
---------------------------------------------------------------------------
|