<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15654
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MATATYPPPPPYYRLYKDYLQNPKSAPEPPPPIERTYVCFGANYTTDYVLPSLEEQGVRRLYPNGPNVDFKKELRSLNRELQLHLLELADVLIERPSQYARRVEDISLIFKNLHHLLNSLRPHQARATLIHILELQIQRRKQAVEDIKRRREEAQKLLKEALGTLDGQ |
Length | 168 |
Position | Middle |
Organism | Manihot esculenta (Cassava) (Jatropha manihot) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Malpighiales> Euphorbiaceae> Crotonoideae> Manihoteae>
Manihot.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.675 |
Instability index | 71.50 |
Isoelectric point | 9.16 |
Molecular weight | 19636.31 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP15654
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.76| 10| 19| 7| 16| 1
---------------------------------------------------------------------------
7- 16 (25.15/10.06) P.PPPPYYRLY
27- 37 (19.61/ 6.67) PePPPPIERTY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 86.73| 22| 41| 85| 106| 3
---------------------------------------------------------------------------
85- 106 (35.25/21.33) LLELADVLIERPSQYARRVEDI
110- 126 (21.67/10.65) FKNLHHLLNSLRPHQAR.....
129- 147 (29.81/17.06) LIHILELQIQRRKQ...AVEDI
---------------------------------------------------------------------------
|