<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15650
Description |
Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MDSSQNATVGTGGNGTLPTHMNDTGAATTADDPKQNLNQVINSIQKTLGLLHQLYLTVSSFNTASQLPLLQRLNGLVVELDNMVKLSEKCNIQVPMEVLNLIDDGKNPDEFTRDVINSCIAKNQVTKGKTDAFKGLRKHLLEELELAFPDEVESYREMRAISAAESKRLAQAQSSLPNGDVKVKAEL |
Length | 187 |
Position | Middle |
Organism | Manihot esculenta (Cassava) (Jatropha manihot) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Malpighiales> Euphorbiaceae> Crotonoideae> Manihoteae>
Manihot.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.384 |
Instability index | 22.56 |
Isoelectric point | 5.23 |
Molecular weight | 20406.88 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146
|
GO - Cellular Component | chromatin GO:0000785 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP15650
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.84| 11| 24| 44| 54| 1
---------------------------------------------------------------------------
44- 54 (18.38/10.99) IQKTLGLLHQL
70- 80 (17.46/10.16) LQRLNGLVVEL
---------------------------------------------------------------------------
|