<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15633
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MAPILEFPPNPNFRFSYGGREDSYATDKFIKFVDDSLHNLRRCHLAKPIKIVCGSAACLFKLIKMATPPGVNFEGNPPAAPQPPGTDMTGMCFRDQLWLNTYPLDRNLIFDYFALSPFYDWTCNNEQLRLQSIHPLDLSQLTKMTGTEYMLSEVMEPNLFVFRKQKRDSPEKVTPMLTYYILDGSIYQAPQLCNVFAARIGRALYYISKAFTTAASKLEKIGYVDEGEGVPCEPKTNKDLIDFKEVKRIDHILASLQRKLPPAPPPTPFPDGYAPPATTEAEKSAETQQGAESQPPVDPIIDQGPAKRMKF |
| Length | 311 |
| Position | Head |
| Organism | Manihot esculenta (Cassava) (Jatropha manihot) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Malpighiales> Euphorbiaceae> Crotonoideae> Manihoteae>
Manihot.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.392 |
| Instability index | 57.07 |
| Isoelectric point | 6.45 |
| Molecular weight | 35022.88 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP15633
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.58| 11| 181| 77| 87| 2
---------------------------------------------------------------------------
77- 87 (24.38/ 8.73) PPAAPQPPGTD
261- 271 (26.20/ 9.86) PPAPPPTPFPD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.22| 14| 29| 92| 105| 4
---------------------------------------------------------------------------
92- 105 (29.85/21.36) CFRDQLWLNT.YPLD
123- 137 (23.37/15.21) CNNEQLRLQSiHPLD
---------------------------------------------------------------------------
|