Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MAPILEFPPNPNFRFSYGGREDSYATDKFIKFVDDSLHNLRRCHLAKPIKIVCGSAACLFKLIKMATPPGVNFEGNPPAAPQPPGTDMTGMCFRDQLWLNTYPLDRNLIFDYFALSPFYDWTCNNEQLRLQSIHPLDLSQLTKMTGTEYMLSEVMEPNLFVFRKQKRDSPEKVTPMLTYYILDGSIYQAPQLCNVFAARIGRALYYISKAFTTAASKLEKIGYVDEGEGVPCEPKTNKDLIDFKEVKRIDHILASLQRKLPPAPPPTPFPDGYAPPATTEAEKSAETQQGAESQPPVDPIIDQGPAKRMKF |
Length | 311 |
Position | Head |
Organism | Manihot esculenta (Cassava) (Jatropha manihot) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Malpighiales> Euphorbiaceae> Crotonoideae> Manihoteae> Manihot. |
Aromaticity | 0.11 |
Grand average of hydropathy | -0.392 |
Instability index | 57.07 |
Isoelectric point | 6.45 |
Molecular weight | 35022.88 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP15633 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 50.58| 11| 181| 77| 87| 2 --------------------------------------------------------------------------- 77- 87 (24.38/ 8.73) PPAAPQPPGTD 261- 271 (26.20/ 9.86) PPAPPPTPFPD --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 53.22| 14| 29| 92| 105| 4 --------------------------------------------------------------------------- 92- 105 (29.85/21.36) CFRDQLWLNT.YPLD 123- 137 (23.37/15.21) CNNEQLRLQSiHPLD --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AEKSAET 2) ILASLQRK 3) PVDPIIDQGPAKRMKF | 281 252 296 | 287 259 311 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab