<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15629

Description Uncharacterized protein (Fragment)
SequenceMKGADEEHQGITAVAIDADKNSQSAVKWAVENLVHGNNPYCVFIHVQCKTTRHGEHLGNLTREGRAPNQQELQQLFLHYRGFCARRGIETKEVVIHDSDVPNALIDYIVHNKIRNIVLGAAQRNALMRKFKNADVPSTLLKIAPESCAVYVIAKGKVQTFRLARRPLHAPTISTHSTGSAHLAGSAHSAASAHSATSAHSAGSTYSTSLILSPLRHHSPSPPFTPSSNASSTSTSRQENHWDVPIESMHPNYKDKYTFRFNGNSLVASPSIRSPESLLNRDFMSNSEFSGPESFVSANTSFDNFEYSASENSKSSNSSQLAILDAEMARLKLELQQSMELFNSVTKEAVLAKNMVRELHRLQTLDRQDVDEEPINEGAELSLIEMDKQKTVAKEAVQKAKRIAAELVAEKKVHHEAEERKKTLESMENNDFSCRRYTIHDIEIATNHFSASHKIGEGGYGPVFKGVLNHINVAIKVLRPDLSQGQKQFRQEVEVLSNMRHPNMVILLGACPEYGCLVYEFMENGSLEDRLCRKDNTPPIPWRTRFKIAFEIATALLFLHETKPEPLVHRDLKPGNILLDPNLVSKIADVGLARLLPPSVANDVTQYRMTAAAGTFYYIDPEYQQTGMLSVKSDLFSFGVVLLQLLTARPPMGLCYQIQDAIDNGNFPDMLDKSVRDWPVKEALSLAKLAVQCCELRKRDRPELATVVWPELKRLRDFALFSEVERETVIPLYGPNDLISPTRSH
Length744
PositionTail
OrganismManihot esculenta (Cassava) (Jatropha manihot)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Malpighiales> Euphorbiaceae> Crotonoideae> Manihoteae> Manihot.
Aromaticity0.07
Grand average of hydropathy-0.387
Instability index41.20
Isoelectric point6.87
Molecular weight83159.46
Publications

Function

Annotated function
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP15629
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.07|      16|      21|     173|     188|       1
---------------------------------------------------------------------------
  173-  188 (30.81/19.59)	STHSTGSAHLAGSAHS
  191-  206 (30.26/19.11)	SAHSATSAHSAGSTYS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      90.42|      26|      32|      43|      74|       2
---------------------------------------------------------------------------
   43-   68 (47.63/40.07)	FIHVQCKTTRHG.EHLGNLTREGRAPN
   76-  102 (42.79/22.41)	FLHYRGFCARRGiETKEVVIHDSDVPN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.46|      15|      16|     274|     289|       3
---------------------------------------------------------------------------
  274-  289 (23.59/23.19)	PESLL..NRDFmSNSEFS
  291-  307 (23.87/16.78)	PESFVsaNTSF.DNFEYS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      67.52|      19|      20|     357|     376|       4
---------------------------------------------------------------------------
  333-  356 (14.56/ 6.72)	ELQ..QSMELfN.SVTKEAVlakNmvR
  357-  376 (27.31/25.40)	ELHrLQTLDR.Q.DVDEEPI...N..E
  379-  398 (25.65/17.61)	ELS.LIEMDK.QkTVAKEAV...Q..K
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.53|      17|     248|     233|     251|       5
---------------------------------------------------------------------------
  212-  228 (32.51/15.85)	SPLRHHSPSPPFTPSSN
  235-  251 (33.02/14.34)	SRQENHWDVPIESMHPN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      59.23|      14|      33|     116|     129|       6
---------------------------------------------------------------------------
  116-  129 (20.86/12.50)	IVLGAAQRNALMRK
  138-  151 (18.64/10.44)	TLLKIAPESCAVYV
  152-  165 (19.74/11.46)	IAKGKVQTFRLARR
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP15629 with Med32 domain of Kingdom Viridiplantae

Intrinsically Disordered Regions

IDR SequenceStartStop
1) HHSPSPPFTPSSNASSTSTSRQENHWDVPIE
216
246

Molecular Recognition Features

MoRF SequenceStartStop
NANANA