<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15627
| Description |
Uncharacterized protein |
| Sequence | MDPETKKFERGPRELTGAVDLISHYKLLPHHDFFCKRSLPLSISDTHYLHNVVGDAEIRKGEGMQLDQLMQNNSYSRDSNTRIQPFDLDVLREAFLFKETTPIELPPSEKGTPTIAAKSKSDSKDKERKHKKHKDKDKEKDKEHKKHKHRHKDKDRSKDKDKEKKDRSGHHDSGGDHSKKHHEKKRKHDGDEDINDVHKHKKSKHKSSKIDEIGAIRVAG |
| Length | 220 |
| Position | Head |
| Organism | Manihot esculenta (Cassava) (Jatropha manihot) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Malpighiales> Euphorbiaceae> Crotonoideae> Manihoteae>
Manihot.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.559 |
| Instability index | 40.52 |
| Isoelectric point | 9.44 |
| Molecular weight | 25558.36 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP15627
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 75.07| 15| 15| 171| 185| 2
---------------------------------------------------------------------------
150- 164 (22.67/ 8.56) RHKDKDRSKDKDKEK
171- 185 (26.75/11.70) HDSGGDHSKKHHEKK
188- 202 (25.66/10.86) HDGDEDINDVHKHKK
---------------------------------------------------------------------------
|