<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15626
| Description |
Uncharacterized protein |
| Sequence | MQLDQLMQNNSYSRDSNTRIQPFDLDVLREAFLFKETTPIELPPSEKGTPTIAAKSKSDSKDKERKHKKHKDKDKEKDKEHKKHKHRHKDKDRSKDKDKEKKDRSGHHDSGGDHSKKHHEKKRKHDGDEDINDVHKHKKSKHKSSKIDEIGAIRVAG |
| Length | 157 |
| Position | Head |
| Organism | Manihot esculenta (Cassava) (Jatropha manihot) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Malpighiales> Euphorbiaceae> Crotonoideae> Manihoteae>
Manihot.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -1.934 |
| Instability index | 42.60 |
| Isoelectric point | 9.64 |
| Molecular weight | 18373.28 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP15626
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.17| 15| 15| 108| 122| 2
---------------------------------------------------------------------------
108- 122 (27.13/ 8.42) HDSGGDHSKKHHEKK
125- 139 (26.04/ 7.80) HDGDEDINDVHKHKK
---------------------------------------------------------------------------
|