<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15593
Description |
Uncharacterized protein |
Sequence | MSHPNPSGNGCSLEDCLTNLFALTDLCGIKWRRLTTDNVNVEPLEDPVLVGFSRCINNDILCVWRRVQRDPDQRQPDFNSSKELWIFWYGDEPESLRQALTPDLGLKEIESGTWDRDKDKDNGLTYECRTLLFKALHNLIERSLLSKNFVRLGRWYVLPYEHGNTDTGVHLSFSFHYFLHGESQVCASIEVKLRPPVWRLTAQHIALVQGNQASIQGKIFLQLYNSSCFVNICCRSEW |
Length | 238 |
Position | Middle |
Organism | Biomphalaria glabrata (Bloodfluke planorb) (Freshwater snail) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Mollusca> Gastropoda>
Heterobranchia> Euthyneura> Panpulmonata> Hygrophila> Lymnaeoidea>
Planorbidae> Biomphalaria.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.362 |
Instability index | 46.34 |
Isoelectric point | 5.98 |
Molecular weight | 27478.87 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP15593
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.92| 16| 32| 26| 43| 1
---------------------------------------------------------------------------
26- 43 (26.84/22.29) LCGikWRRLTTDNVNVEP
61- 76 (33.08/20.82) LCV..WRRVQRDPDQRQP
---------------------------------------------------------------------------
|