<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15591
| Description |
Uncharacterized protein |
| Sequence | MASQAPVLSQAPQHHYSLQREWSHQSNSMMSPASTSQLMSPTKDNAVNICGFGQEIVQDIVSKAQEVFNLLKANSMQLPNNVTFHGQQYTERKGKLAEQLQQVTMNFKRLRAFYSKVNELCEQIEIPSEQELVPYVGQEVDKTQSYSEVYLYVSEQHRDMLEQIHWKNQQLKEVIDSMRSIIWEINTMITMRKT |
| Length | 194 |
| Position | Head |
| Organism | Biomphalaria glabrata (Bloodfluke planorb) (Freshwater snail) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Mollusca> Gastropoda>
Heterobranchia> Euthyneura> Panpulmonata> Hygrophila> Lymnaeoidea>
Planorbidae> Biomphalaria.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.603 |
| Instability index | 60.67 |
| Isoelectric point | 6.07 |
| Molecular weight | 22528.31 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP15591
No repeats found
No repeats found
|