<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15585
| Description |
Uncharacterized protein |
| Sequence | MAASGQGLVPMNNQIPVSSVMHHQVGMGPVMVGMGPGIGVGVGPPMPPNPQVPMVQNPVPPETDPIAKFKILLPRLKESLVNLFKTGGHLFYQNASQDETGAQMDNASGRFEKCLEEFYAICDLVEIYLKLAYEVIQQDKDSTRNTPNLILPQKTDAPQPEGQLYSQYLSTIRAQINCAKDIRDLLHDCLKNLPEHSHP |
| Length | 199 |
| Position | Tail |
| Organism | Biomphalaria glabrata (Bloodfluke planorb) (Freshwater snail) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Mollusca> Gastropoda>
Heterobranchia> Euthyneura> Panpulmonata> Hygrophila> Lymnaeoidea>
Planorbidae> Biomphalaria.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.305 |
| Instability index | 43.20 |
| Isoelectric point | 5.63 |
| Molecular weight | 21868.93 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP15585
No repeats found
|