<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15573
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MADMIRRPDPMQSSPRSSPRDRGSRSPAYPRQDSSGTLKTTISLAPGKTPAVIHTGSFYLVKDIPDEAEITGSTNLLNYYNLEHSYNRFLNKKVKEELSAFLPHLPGNIDSPGIQDNSSLRSLIEKTPITGKELTQLSGSALSGFRLHPGPLPEQYQLMNQMTQKKKRHKKKIKDSEKGSTLQLSQNSATGEPETKKTKRPKKEDDQKDSKKKRKKDKKKKKVF |
| Length | 224 |
| Position | Head |
| Organism | Biomphalaria glabrata (Bloodfluke planorb) (Freshwater snail) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Mollusca> Gastropoda>
Heterobranchia> Euthyneura> Panpulmonata> Hygrophila> Lymnaeoidea>
Planorbidae> Biomphalaria.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.131 |
| Instability index | 57.62 |
| Isoelectric point | 9.99 |
| Molecular weight | 25231.48 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP15573
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 72.90| 15| 43| 160| 174| 1
---------------------------------------------------------------------------
160- 174 (26.89/11.50) NQMTQKKKRHKKKIK
192- 204 (21.64/ 8.13) EPETKKTKRPKK..E
206- 220 (24.36/ 9.87) DQKDSKKKRKKDKKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.59| 11| 41| 98| 109| 2
---------------------------------------------------------------------------
98- 109 (17.92/15.47) LSAFLPHlPGNI
142- 152 (22.67/14.39) LSGFRLH.PGPL
---------------------------------------------------------------------------
|