| Description | Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MDRKEKRFESEEQQRTRFQIELEFVQCLANPNYLNFLAQRGYFKDQNFINYLKYLLYWKEPKYAKFLKYPQCLHMLELLQYEHFRKELVNSQCAKFIDDQQLLHWQHYQRKRSALLQEQAEKSQTSKDVKEPKQISAQSVT |
| Length | 141 |
| Position | Middle |
| Organism | Biomphalaria glabrata (Bloodfluke planorb) (Freshwater snail) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Mollusca> Gastropoda> Heterobranchia> Euthyneura> Panpulmonata> Hygrophila> Lymnaeoidea> Planorbidae> Biomphalaria. |
| Aromaticity | 0.14 |
| Grand average of hydropathy | -0.949 |
| Instability index | 45.27 |
| Isoelectric point | 9.05 |
| Molecular weight | 17349.61 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP15565
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 133.36| 38| 44| 22| 59| 1
---------------------------------------------------------------------------
22- 59 (68.85/35.73) LEFVQCLANPNYLNFLAQRGYFKDQNFINYL..KYLLYWK
67- 106 (64.51/33.13) LKYPQCLHMLELLQYEHFRKELVNSQCAKFIddQQLLHWQ
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) DRKEKRFE 2) KDVKEPKQISAQ | 2 127 | 9 138 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab