<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15564
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MESEEQQRTRFQIELEFVQCLANPNYLNFLAQRGYFKDQNFINYLKYLLYWKEPKYAKFLKYPQCLHMLELLQYEHFRKELVNSQCAKFIDDQQLLHWQHYQRKRSALLQEQAEKSQTSKDVKEPKQISAQSVT |
| Length | 134 |
| Position | Middle |
| Organism | Biomphalaria glabrata (Bloodfluke planorb) (Freshwater snail) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Mollusca> Gastropoda>
Heterobranchia> Euthyneura> Panpulmonata> Hygrophila> Lymnaeoidea>
Planorbidae> Biomphalaria.
|
| Aromaticity | 0.14 |
| Grand average of hydropathy | -0.842 |
| Instability index | 45.25 |
| Isoelectric point | 8.69 |
| Molecular weight | 16389.52 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP15564
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 133.36| 38| 44| 15| 52| 1
---------------------------------------------------------------------------
15- 52 (68.85/39.53) LEFVQCLANPNYLNFLAQRGYFKDQNFINYL..KYLLYWK
60- 99 (64.51/36.66) LKYPQCLHMLELLQYEHFRKELVNSQCAKFIddQQLLHWQ
---------------------------------------------------------------------------
|