Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MESEEQQRTRFQIELEFVQCLANPNYLNFLAQRGYFKDQNFINYLKYLLYWKEPKYAKFLKYPQCLHMLELLQYEHFRKELVNSQCAKFIDDQQLLHWQHYQRKRSALLQEQAEKSQTSKDVKEPKQISAQSVT |
Length | 134 |
Position | Middle |
Organism | Biomphalaria glabrata (Bloodfluke planorb) (Freshwater snail) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Mollusca> Gastropoda> Heterobranchia> Euthyneura> Panpulmonata> Hygrophila> Lymnaeoidea> Planorbidae> Biomphalaria. |
Aromaticity | 0.14 |
Grand average of hydropathy | -0.842 |
Instability index | 45.25 |
Isoelectric point | 8.69 |
Molecular weight | 16389.52 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP15564 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 133.36| 38| 44| 15| 52| 1 --------------------------------------------------------------------------- 15- 52 (68.85/39.53) LEFVQCLANPNYLNFLAQRGYFKDQNFINYL..KYLLYWK 60- 99 (64.51/36.66) LKYPQCLHMLELLQYEHFRKELVNSQCAKFIddQQLLHWQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) LLHWQHYQRKRSALLQEQA 2) TSKDVKEPKQISAQSV | 95 118 | 113 133 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab