<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15562
| Description |
Uncharacterized protein |
| Sequence | MGAEDEIIKIGKKLEKLISSNTADHSSALDLLKALRDTKMTLEVLQKTRIGMTVNNLRKASSNDEVVSLAKTLIKHWKRLLPADSPGGISRSNSRSSGDASSQRMDETSNDGTEESKGDSSKDGQSGQTRTQNTTDAVRIKCRELLSNALKASEIPDGAHNPDELAASIEDAIFEEFGNTEMKYKNRVRSRVANLKDARNPQLRQNVLIGLISAQKIASMSAEEMASKEMKQLREKLTKEAIDDHQMAKTGGTTTDLFKCGKCRKNNCTYNQVQTRSADEPMTTFVFCNECGNRWKFC |
| Length | 298 |
| Position | Unknown |
| Organism | Biomphalaria glabrata (Bloodfluke planorb) (Freshwater snail) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Mollusca> Gastropoda>
Heterobranchia> Euthyneura> Panpulmonata> Hygrophila> Lymnaeoidea>
Planorbidae> Biomphalaria.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.756 |
| Instability index | 44.07 |
| Isoelectric point | 8.74 |
| Molecular weight | 32998.87 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | nucleic acid binding GO:0003676 IEA:InterPro
zinc ion binding GO:0008270 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP15562
No repeats found
|