<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15561
Description |
Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MSSNLMVGAPREKLLALEKIEKDIAAALQSAGQALQELSKDKPALKHVESHSSNFLKTLQEIENGLSQQITYLSQVTTGQAHEGSSYASQKDHHMSLHRLEHVKSRLGELEKIKQEHLRQKHSGIIRTYSLPEQSHQPHTPQQQQALTPQPQQQQKQRDQQREQQAQL |
Length | 168 |
Position | Head |
Organism | Biomphalaria glabrata (Bloodfluke planorb) (Freshwater snail) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Mollusca> Gastropoda>
Heterobranchia> Euthyneura> Panpulmonata> Hygrophila> Lymnaeoidea>
Planorbidae> Biomphalaria.
|
Aromaticity | 0.02 |
Grand average of hydropathy | -1.017 |
Instability index | 62.87 |
Isoelectric point | 8.84 |
Molecular weight | 19086.16 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP15561
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.04| 15| 15| 131| 145| 1
---------------------------------------------------------------------------
131- 145 (28.77/13.22) LPEQSHQPHTPQQQQ
147- 161 (27.27/12.16) LTPQPQQQQKQRDQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 104.50| 34| 54| 31| 69| 2
---------------------------------------------------------------------------
31- 69 (46.04/44.13) AGQALQELSKDKpaLKHVESHSSNFLKTLQEienGLSQQ
88- 121 (58.46/38.75) ASQKDHHMSLHR..LEHVKSRLGELEKIKQE...HLRQK
---------------------------------------------------------------------------
|