<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15557
Description |
Uncharacterized protein |
Sequence | MSQGQSALPQNKEAQLRSYQVHLKDNIRSMYDNFTEIIRLARVSEKIEEDGQLLRPTQIDQDNYEMQVRAANIVKAGESLMKLVSDLKQFLILNDFPSVNEAISHNAKMHKENQINIDMKLMKLRDEMAADLYELEDEYYSSLYK |
Length | 145 |
Position | Head |
Organism | Biomphalaria glabrata (Bloodfluke planorb) (Freshwater snail) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Mollusca> Gastropoda>
Heterobranchia> Euthyneura> Panpulmonata> Hygrophila> Lymnaeoidea>
Planorbidae> Biomphalaria.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.650 |
Instability index | 66.91 |
Isoelectric point | 5.09 |
Molecular weight | 16931.04 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP15557
No repeats found
|