<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15552
| Description |
Uncharacterized protein |
| Sequence | MMNQMGMMMQQQGVGVPGGPGGVGGVGMPGPGGVGVGGPGMMQSPQMQQAQQQQVQQQQVQQQQQQQQQQVQQQQVQQQAQQQQQQHSQSSQQQAQQTEKVDNISKVKVLVGPLRDALSTTIKTAAQLIQQNTLADAGSKTVDLNNAPRFDKHLEEFYSICDQIELNLKTAKLCMQQSASSQQYLPIPVATSQPPLTETNALTYNQYLEVVKLQIGYAKDIHDTLICAAQNISPSE |
| Length | 236 |
| Position | Tail |
| Organism | Anopheles culicifacies |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles> culicifacies species complex.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.643 |
| Instability index | 66.49 |
| Isoelectric point | 5.56 |
| Molecular weight | 25740.67 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP15552
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.02| 15| 18| 51| 68| 1
---------------------------------------------------------------------------
51- 68 (26.16/ 9.34) QqqqVQQQQVQQQQQQQQ
70- 84 (30.86/ 6.81) Q...VQQQQVQQQAQQQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.78| 15| 18| 6| 21| 2
---------------------------------------------------------------------------
6- 21 (28.78/18.88) GMMMQQQ.GVGVpGGPG
25- 40 (28.99/13.98) GVGMPGPgGVGV.GGPG
---------------------------------------------------------------------------
|