<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP15550

Description Mediator of RNA polymerase II transcription subunit 5
SequenceMDKLSADGSDEAKAALRPSMLYWSTFVSRCITQRLETAKFHEFVQLVHEKHPLPPVLVADFFLKPQPSNNVSLDPRIPPYIQVLSQLGYVDALSILHTLHRYSSINAHLRRPDDDAKHDMQQRPLWRTSAWVEEFMFYHVIKTLVEGSAFCDTRSALVLIKVVCRWMNLFSAASAVFATDVLAQVQFSQAREDLDLSRAAFLPLLLRLVETPTLIEAISPPYAKGIRRELSEALTGFMHTMQPAPGFVERLEMFRTDTLARLDPLFKKKQADANAAMDELLEPAMRLENFVVPEIPITNSRAGLYVYLNAAGETQSSAIDLILASFDILANTVFRNECPKDAHLLRSFLINKLPLLLCQLFAPQFSTASSEFCITEALNQVDTSVFPTASLMFDESRSNNPYTESVREEFCTACALHGLVQREHLERILGETSMSYEPSLEKYSKDKLVQSCLSDPEKIQGLVREIDKMDGNVGAVCQALVELMRQLCDSKETMSLKLLCGQLAHKPQSLDIVLLFERLPTVLEPLCQLLDNWRYDDDQGEYQPIYEEFGAILLLVLAYAYRYNLRAADIGIVSPDSCVAKILNRAHISRPLGQLTEPEKGHVNGWIHGLFGNETGGLGDDLMSSCPPQDFYLVVASIFQYIVVAYSNGYLNDESLKSGIEYVVDTFLLPSLVPAIRFLADYLWVEQREQKSVIKILQLMLLPSSISGEANTMLSSVKNLIAKPLEYSLRSYQKQDPKNQDIQPLLRALKDSLPLSRRTGGADNNELESWSSSSSSGLSGAVRHTVQGLVQMHHGINVMPTSYTHRQLIAACRMVGTSKVLRAMVDEVRHQSEAGAASVVYDVVAALVCAPDVTMEPPTGSLLGSEARGTQRRPTLREALKLEAEGCQKLHKKDPSLAEAVVRLHRRVEALMALPPAQAMLQAPDMTLDLSGAPAGLGDAISAAVAAQGGDAMVVDTVGLDMGSSDLGLGATGVETTSDGDIFGGIDAGMDVFSGWDGMDTSGG
Length1004
PositionTail
OrganismOphiocordyceps camponoti-rufipedis
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Ophiocordycipitaceae> Ophiocordyceps.
Aromaticity0.07
Grand average of hydropathy-0.045
Instability index42.78
Isoelectric point5.20
Molecular weight110689.62
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP15550
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      81.29|      27|      29|     928|     956|       1
---------------------------------------------------------------------------
  897-  924 (38.17/16.86)	LAEAVVRLHRRVEALMALPPAQAMLqAP
  930-  956 (43.12/26.76)	LSGAPAGLGDAISAAVAAQGGDAMV.VD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.16|      14|      36|     657|     671|       3
---------------------------------------------------------------------------
  657-  671 (20.22/19.94)	KSGIEyVVDTFLLPS
  691-  704 (23.94/16.57)	KSVIK.ILQLMLLPS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.23|      15|      29|     959|     973|       4
---------------------------------------------------------------------------
  959-  973 (26.81/16.43)	GLDMGSSDLGLGATG
  989- 1003 (30.41/19.67)	GMDVFSGWDGMDTSG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     148.42|      43|     460|      45|      87|       5
---------------------------------------------------------------------------
   45-   87 (77.36/48.20)	QLVHEKHPLP.PVLVADFFLKPQPSNNVSLDPRIPPYIQVLSQL
  486-  529 (71.06/43.68)	QLCDSKETMSlKLLCGQLAHKPQSLDIVLLFERLPTVLEPLCQL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.76|      19|      22|     815|     835|       9
---------------------------------------------------------------------------
  815-  835 (26.36/22.65)	VgtSKVLRAMV..DEVRHQSEAG
  840-  860 (28.40/16.94)	V..YDVVAALVcaPDVTMEPPTG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP15550 with Med5 domain of Kingdom Fungi
Unable to open file!