| Description | Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MESTNEPPLDEIQWRSPPIVAQMGGLHSNTILFYFAESPFFERTSNNAVIMSQALNNMSMYHYIQTREAFEGRLKTMSGLEFIVGEEPAETGPGAGTGVWVIRKQTRRKRYQEADEITVHASFFIVGENIYKSPSLANILASRIMTISTAMAKALPAAEKARSWRAATGHVYPPLPNTQSTSKHRAQTSKENSPTADAPKSASASRNNDEASLERAAEEAFMIHMRYGGEYIDENPITGRPGEFHLSSTGRKAVLPPPPPKTDQPLGMGAMNGPAPINTKLEDRRDSKTDKTPKSATHPKPKRRKSKMSNGPTPAQTPTAS |
| Length | 321 |
| Position | Head |
| Organism | Ophiocordyceps australis |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Ophiocordycipitaceae> Ophiocordyceps. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.704 |
| Instability index | 55.40 |
| Isoelectric point | 9.45 |
| Molecular weight | 35251.36 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP15521
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 181.71| 39| 39| 236| 274| 1
---------------------------------------------------------------------------
148- 174 (34.37/14.16) ............STAM..AKALPAAEKARSWRAATGHVYPP
176- 200 (24.80/ 8.39) P.NTQSTSKHRAQTSK.eNSPTADAPK..............
236- 274 (68.30/34.64) PITGRPGEFHLSSTGR..KAVLPPPPPKTDQPLGMGAMNGP
276- 312 (54.24/26.16) PINTKLEDRRDSKTDKtpKSATHPKPKRRKSKMS....NGP
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) INTKLEDRRDSK 2) KSATHPKPKRRKSKMS | 277 294 | 288 309 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab